PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi011096
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family G2-like
Protein Properties Length: 451aa    MW: 49738.7 Da    PI: 8.1194
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S55421795PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.13.6e-2792144255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                +r++Wt +LH++Fv av+qL G++kA+Pk+i+e+mkv+gL++e+v+SHLQkYRl
  Psi011096  92 ARVHWTVQLHQQFVVAVNQL-GIDKAVPKKIVEIMKVQGLSRENVASHLQKYRL 144
                79******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.2E-9159No hitNo description
SuperFamilySSF521721.61E-6143IPR011006CheY-like superfamily
PROSITE profilePS5011015.153139IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS512949.73188147IPR017930Myb domain
SuperFamilySSF466891.13E-1889148IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-2790149IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-2392144IPR006447Myb domain, plants
PfamPF002499.6E-693143IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MSTNGDTSVV MKGITHGACD YFIKPIRIEE LRNIWQHVVR RRGRESLKDD LGECEDREAS  60
DSPETTSKKR KDTSSGDFSD EVIDDISSLK RARVHWTVQL HQQFVVAVNQ LGIDKAVPKK  120
IVEIMKVQGL SRENVASHLQ KYRLYLKRLS GAISEPYPVA SFQAADDSVS GGMMKLQQGE  180
KGVTSSSGAK GLNLGTGVSS SLGVRGLDQS TLKSLQQYRS YQQKLVANRA QILGGIGICS  240
PNFSNTAKVP ESMGGSKSGL QRMSSVDMGL LWKAQRELAA DENEKHGTAN LQNLSQKKLN  300
SSEQRRFRGS HPRHSRTRTL TDMPIVFQSA KPEVTFQNTP PAKSMLQDVD ELLPMDDISW  360
LDSTFRPESP IDSTFRPESP RAAVILFDTF VQDVGGSSHS AATTEESNRH AFASTDFEGR  420
KKAGVGNEDF FSSGSTDISD YLVDDLIPHP R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-1887150164ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002989348.17e-72hypothetical protein SELMODRAFT_447635
TrEMBLD5A9D60.0D5A9D6_PICSI; Putative uncharacterized protein
STRINGEFJ096222e-71(Selaginella moellendorffii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.16e-49response regulator 2